GHRF [1-44] Peptide,Cas:83930-13-6
Growth Hormone Releasing Factor (1-44) Peptide
Product description
The growth hormone-releasing factor (GHRF) is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone. GHRH is available under the names Groliberin (Pharmacia), Somatrel (Ferring) and Geref (acetylated aa 1-29, Serono) for the treatment of growth hormone deficiency.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 83930-13-6 |
Synonyms | Somatoliberin; growth hormone-releasing factor; GRF; growth hormone-releasing hormone; GHRH; somatocrinin; somatorelin; sermorelin; GHRF |
Sequence | H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2 or H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 |
Molecular Formula | C215H358N72O66S |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product