X
Email:
sales@ruixibiotech.com

GHRF [1-44] Peptide,Cas:83930-13-6

Growth Hormone Releasing Factor (1-44) Peptide

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-1350 1mg 249.00
- +
+ Add to cart

Product description

The growth hormone-releasing factor (GHRF) is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone. GHRH is available under the names Groliberin (Pharmacia), Somatrel (Ferring) and Geref (acetylated aa 1-29, Serono) for the treatment of growth hormone deficiency.


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 83930-13-6
Synonyms Somatoliberin; growth hormone-releasing factor; GRF; growth hormone-releasing hormone; GHRH; somatocrinin; somatorelin; sermorelin; GHRF
Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2 or H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Molecular Formula  C215H358N72O66S
Storage -20℃, protected from light and moisture
Transportation 4-25℃ temperature for up to 3 weeks
Stability 1 year
Document

Related Product